DATA CHECKED OCT 2026
All states / Minnesota

RTK corrections in Minnesota

Free  26 options · MnCORS · Minnesota DOTDepartment of Transportation. The state agency that runs many of the free state RTK networks.Full definition · 2 regional/private network(s)

Compare all 26 RTK options in Minnesota

Every way to get RTKReal-time kinematic. A way to make GPS accurate to about an inch by getting live corrections from a nearby base station.Full definition CorrectionsLive info from a base station about how far off the satellite signals are, so your rover can cancel out the error.Full definition here, side by side: the state network, regional or private networks, and nationwide services. Tap a name for the full details page. Want to know about one exact spot? Check an address or ZIP →

OptionAccessPriceFree trialCasterMount typesNotesChecked
MnCORS
State-run network
FreeNot published—mncors.dot.state.mn.us:9000Network (13 mountpoints by format and adjustment; AG mounts for agricuMinnesota DOT2026-10-17
Trimble VRS Now (mapped states)
Commercial network
PaidNot published (buy through Trimble dealers or the Trimble store)—www.vrsnow.us:2101Not publishedTrimble. States with 5 or more stations on Trimble's official VRSVirtual reference station. The network blends nearby stations to create a pretend base right next to you, which keeps the baseline short.Full definition Now US sensor map (510 stations, checked 2026-10-16). Fewer stations show in KS, MO, MT, TN, WA, WI and WY2026-10-17
Rural Tower Network
Ag network (dealer)
PaidNot published—After signupNot publishedButler Machinery, RDO Equipment, Titan Machinery (dealer-owned). Ag RTK tower network; subscriptions sold through the member dealers2026-10-16
Point One Navigation Polaris
Commercial network
PaidVirtual RTK $42/mo per license (~10 cm); True RTK $125/mo per license (1-3 cm); annual discounts14 days, no credit card required; includes Virtual RTK or Trpolaris.pointonenav.com:2101Not publishedUS nationwide. Check the provider's coverage map for your area.2026-10-17
GEODNET RTK
Community network
Paid$40/mo or $400/yr per deviceFree RTK trial offered (link on store page)rtk.geodnet.com:2101Nearest single baseGlobal community-built network. Check the provider's coverage map for your area.2026-10-17
RTKdata
Commercial network
Paid$40/mo, $400/yr, or $1,920 for 5 yrs per device30 days, full service, no credit card, no auto-renewrtk.rtkdata.com:2101Nearest single baseGlobal. Check the provider's coverage map for your area.2026-10-17
E38 RTK Premium
Reseller
PaidFrom $100 (shortest term; see page for durations)—rtkpremium.xyz:2101Not publishedReseller; coverage varies by state. Check the provider's coverage map for your area.2026-10-17
Emlid Corrections
Commercial network
Paid1 yr included with eligible Reach receivers; top-up $699/1 yr or $1,199/3 yr per device (via E38)—NotNot publishedEmlid receivers only. Check the provider's coverage map for your area.2026-10-17
u-blox PointPerfect Flex
Commercial network
PaidFrom $5.90/mo (up to 100 hrs); 30-day free trial30-day free trial (u-blox and non-u-blox receivers)ppntrip.services.u-blox.com:2101Not publishedRTK-SSR, global. Check the provider's coverage map for your area.2026-10-17
Swift Navigation Skylark
Commercial network
PaidFrom $69/mo (1 cm RTK) or $29/mo (sub-decimeter RTK-SSR) per ArduSimple14 daysna.l1l2:2101Not publishedCheck the provider's coverage map for your area.2026-10-17
Leica (HxGN) SmartNet
Commercial network
PaidNot published—<state:9301iMAX network, nearest single basePrice not published. Check the provider's coverage map for your area.2026-10-17
Trimble VRS Now
Commercial network
PaidNot published—www.vrsnow.us:2101Not publishedPrice not published. Check the provider's coverage map for your area.2026-10-17
Topcon Topnet Live
Commercial network
Paid$1,800 new US subscription (Topcon store); monthly/project terms via dealers—After signupNot publishedUS network, 200 stations added Jan 2025; works with any network RoverThe receiver that moves around the job, like a survey pole or a drone. It uses the base's corrections to find its exact spot.Full definition. Check the provider's coverage map for your area.2026-10-17
Carlson SkyNet RTN
Commercial network
Paid$1,500/yr; 14-day free trial14 daysAfter signupNot publishedUS nationwide, single NTRIPThe standard way RTK corrections are sent over the internet. Think of it as internet radio for correction data.Full definition Mount pointOne specific correction stream on a caster, like one channel on a radio. Each one comes from a certain station or network setup.Full definition, 1,700+ bases. Check the provider's coverage map for your area.2026-10-17
RTK2GO
Free community CasterThe internet server that hands out correction streams. Your rover logs in to it, like tuning into a radio station.Full definition
FreeFree community caster; no quality guarantees—rtk2go.com:2101Not publishedCoverage depends on volunteer bases. Check the provider's coverage map for your area.2026-10-17
NOAA NGS CORS
Post-processing data
FreeFree post-processing data (RINEXA standard file format for raw GPS data. Any brand of receiver or software can read it.Full definition); not a real-time RTK service—NotNot publishedUse for PPKPost-processed kinematic. Like RTK, but the corrections are applied after the job using recorded data, so no live link is needed.Full definition, not live RTK. Check the provider's coverage map for your area.2026-10-17
Onocoy
Nationwide / community
Paid$20 per 30 days + $0.15/hr used—clients.onocoy.com:2101Nearest single baseCommunity-built global network; pay per hour. Check the provider's coverage map for your area.2026-10-17
EarthScope NOTA real-time streams
Nationwide / scientific
FreeFree for non-commercial use; commercial license required—ntrip.earthscope.org:2101Single base (you pick a station)Science-grade stations (NOTA); pick a station near you. Check the provider's coverage map for your area.2026-10-17
Emlid Caster
Free relay for your own base
FreeFree (relay for your own Base stationA GNSS receiver sitting still on a known spot. It figures out how wrong the satellite signals are right now and shares that as corrections.Full definition)—caster.emlid.com:2101Your own base (single base)Not a network: sends YOUR base's corrections to your rover over the internet. Check the provider's coverage map for your area.2026-10-17
Trimble CenterPoint RTX
Nationwide / satellite PPP
Paid$1,150/yr (US dealer listing)—NotPPP (RTX), delivered by L-band satellite or internetSatellite PPP; works without cell signal; Trimble receivers. Check the provider's coverage map for your area.2026-10-17
Trimble Catalyst
Nationwide / subscription GNSSGlobal Navigation Satellite System. The general name for GPS (USA) and the other satellite systems like GLONASS, Galileo and BeiDou.Full definition
Paid$455/mo per user (dealer listing)—NotNot publishedSubscription GNSS for phones/tablets with the DA2 antenna. Check the provider's coverage map for your area.2026-10-17
NovAtel TerraStar
Nationwide / satellite PPP
PaidNot published (dealer quote)—sid-output.com:2101PPP corrections by L-band satellite or internetSatellite PPP (also sold as Leica SmartLink and by Ag Leader). Check the provider's coverage map for your area.2026-10-17
John Deere RTK
Ag network (dealer)
PaidNot published (dealer); forum reports ~$1,250-$1,500/machine/yr—NotNot publishedAg: StarFire receivers via Deere dealers. Check the provider's coverage map for your area.2026-10-17
Case IH AFS RTK+
Ag network (dealer)
Paid$838.10/yr (dealer listing)—After signupNot publishedAg: cellular RTK for Case IH AFS receivers. Check the provider's coverage map for your area.2026-10-17
New Holland PLM RTK+
Ag network (dealer)
PaidNot published (dealer subscription)—After signupNot publishedAg: cellular RTK to a tractor modem, 1.5 cm. Check the provider's coverage map for your area.2026-10-17
IGS real-time streams (IGS-IP / BKG)
Scientific network
FreeFree (registration required)—igs-ip.net:2101Single global stations (raw data) and SSR products for real-time PPPScience streams: raw global stations and real-time PPP orbit/clock corrections; not a plug-and-play RTK service. Check the provider's coverage map for your area.2026-10-17
NOAA CORS (NCN)Free Post-processing onlyFree—No caster (download files)Post-processing (RINEX)53 station(s) in state. RINEX for PPK and OPUSOnline Positioning User Service. A free NOAA website: upload a GPS file and it emails back the precise position of that spot.Full definition, not live RTK. Stations ↓—

MnCORS

Free
Operator
Minnesota DOT
Access
Free
Price
Not published
Coverage
Minnesota

NTRIP caster

casterProvided by the operator after registration
Operator portal is live. The MnDOT info page timed out.
Sign up / request access →Network info & station mapFull network details →
Partially verifiedChecked 2026-10-16 · operator source · Sources: [1] [2]

PPK with NOAA CORS in Minnesota

NOAANational Oceanic and Atmospheric Administration. The US agency that includes NGS and runs the CORS network.Full definition's permanent base stations record satellite data all day and post it free. You can download those files and use them after a job to correct your drone or rover data (PPK), or to pin down your own base with OPUS. This is not live RTK. This state has 53 working station(s). Each NGSNational Geodetic Survey. The part of NOAA that runs the official US coordinate system, CORS and OPUS.Full definition site log has the station's name and details.

LakevilleSt. CloudRochesterDuluthMoorheadLakevilleSt. CloudRochesterGDMAMNANMNASMNAVMNAXMNBDMNBEMNBJMNBVMNCAMNCLMNDNMNDTMNDVMNEMMNEYMNFFMNGPMNGRMNHDMNHKMNHNMNHWMNHYMNJCMNJFMNKAMNLCMNLKMNLSMNMEMNMGMNMNMNMRMNMSMNOKMNPSMNREMNRMMNRTMNRVMNSBMNSCMNSQMNSVMNTFMNVIMNVNMNVTMNWHMNWNMORHZMP1
Tap or hover a dot: — NOAA CORSContinuously Operating Reference Station. A permanent GPS receiver that records satellite data all day, every day.Full definition station   City
53 operational NOAA CORS stations plotted at their published positions (NGS ITRF2020 coordinates). State outlines: US Census Bureau via us-atlas. Cities: Natural Earth (public domain).
Station IDLat, LonNGS links
GDMA47.7486, -90.3413Coordinates · Site log
MNAN45.1955, -96.0216Coordinates · Site log
MNAS48.2940, -92.9704Coordinates · Site log
MNAV44.7329, -93.2097Coordinates · Site log
MNAX45.8876, -95.3915Coordinates · Site log
MNBD48.6277, -94.0673Coordinates · Site log
MNBE43.6629, -94.1221Coordinates · Site log
MNBJ47.5013, -94.9377Coordinates · Site log
MNBV43.6083, -96.3782Coordinates · Site log
MNCA43.6330, -91.4963Coordinates · Site log
MNCL44.9493, -95.4098Coordinates · Site log
MNDN48.5724, -96.9147Coordinates · Site log
MNDT46.8230, -95.8598Coordinates · Site log
MNDV44.0572, -95.5971Coordinates · Site log
MNEM46.6881, -93.9545Coordinates · Site log
MNEY43.9556, -92.2054Coordinates · Site log
MNFF46.2736, -96.0558Coordinates · Site log
MNGP47.2236, -93.4841Coordinates · Site log
MNGR45.5583, -96.4941Coordinates · Site log
MNHD44.4589, -96.4355Coordinates · Site log
MNHK48.7724, -96.9493Coordinates · Site log
MNHN45.9849, -92.9483Coordinates · Site log
MNHW44.9060, -93.9867Coordinates · Site log
MNHY47.9492, -95.6259Coordinates · Site log
MNJC46.9783, -93.2737Coordinates · Site log
MNJF44.0836, -95.1200Coordinates · Site log
MNKA45.1452, -95.0149Coordinates · Site log
MNLC44.4783, -93.2924Coordinates · Site log
MNLK43.6387, -95.1186Coordinates · Site log
MNLS44.4412, -93.9069Coordinates · Site log
MNME45.1295, -94.5292Coordinates · Site log
MNMG48.1346, -93.8785Coordinates · Site log
MNMN44.5445, -94.9956Coordinates · Site log
MNMR44.9362, -96.4421Coordinates · Site log
MNMS44.4637, -95.7957Coordinates · Site log
MNOK44.9990, -92.9636Coordinates · Site log
MNPS43.5150, -91.8852Coordinates · Site log
MNRE47.0585, -93.9067Coordinates · Site log
MNRM43.6374, -95.7701Coordinates · Site log
MNRT46.4905, -96.2913Coordinates · Site log
MNRV48.7894, -95.0512Coordinates · Site log
MNSB45.4883, -95.5622Coordinates · Site log
MNSC45.7130, -94.9313Coordinates · Site log
MNSQ47.6037, -94.1267Coordinates · Site log
MNSV43.9025, -92.4822Coordinates · Site log
MNTF48.1192, -96.2074Coordinates · Site log
MNVI47.5233, -92.5615Coordinates · Site log
MNVN46.4134, -95.0546Coordinates · Site log
MNVT48.9710, -97.2016Coordinates · Site log
MNWH48.1502, -94.5120Coordinates · Site log
MNWN44.0650, -91.7126Coordinates · Site log
MORH46.8842, -96.7638Coordinates · Site log
ZMP144.6375, -93.1521Coordinates · Site log
  • Download: daily RINEX files (a standard GPSThe US satellite navigation system. People often use "GPS" to mean all satellite positioning.Full definition file type) at geodesy.noaa.gov/corsdata/rinex/YYYY/DDD/ssss/ or the AWS mirror. Custom time spans are available from UFCORS.
  • How often it records: after 30 days, NGS thins daily files to one reading every 30 seconds. Full-rate data is available from NOAA NCEI CLASS.
  • Set your own base: OPUS. See our OPUS how-to.
PPK how-to →OPUS how-to
Source: NGS CORS data access · station list from NGS ITRFInternational Terrestrial Reference Frame. A worldwide datum. In the US it's about a meter different from NAD 83.Full definition coordinate file (Oct 14, 2026).

Reliability reports

Collecting soon

No user reports yet for Minnesota networks. We only show real reports from real users, never sample data. Report collection opens soon, and here's what we'll ask:

Want to be first to report? Use the submit form or subscribe below.

Something wrong or out of date? Report it.

Get a quote

Coming soon

Soon you'll be able to ask local dealers for RTK quotes in Minnesota, all in one form. This form is not open yet. It's switched off, and nothing you type here is sent or saved. Want to know when it opens? Join the monthly email below.

Quick answers

Is there a free RTK network in Minnesota?

Yes. MnCORS is listed as free. Check the operator's terms before you sign up.

How many RTK correction options are there in Minnesota?

FixFinder lists 26: 1 state-run network, 2 regional or private network(s), and 23 nationwide services.

How much does MnCORS cost?

Not published

What is the NTRIP caster for MnCORS?

The operator gives the caster address after you register. FixFinder has not found it published.

Nearby states and related pages

Iowa RTK networksFreeNorth Dakota RTK networksPaidSouth Dakota RTK networksPaidWisconsin RTK networksPaidTrimble VRS Now (mapped states)RegionalRural Tower NetworkRegionalFree vs paid RTK networksHow-toNTRIP setup guidesHow-to

Price changes. New stations.
Once a month.

New state networks, price changes and reliability reports. One email a month, no spam.